PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009759701.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 209aa    MW: 23139.8 Da    PI: 7.8374
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009759701.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.68.9e-33115171158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     dep++VNaKQy++Il+RRq+Rak+e+ekkl  k+rkpylheSRh hAl+R+Rg+gGrF
  XP_009759701.1 115 DEPVFVNAKQYHGILRRRQSRAKAESEKKL-LKARKPYLHESRHLHALKRARGCGGRF 171
                     79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-35113174IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.593114174IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.3E-27116171IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-23117139IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860119139IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.2E-23148171IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MTSSLHYHSD GSENEQPEKQ SEAHSESSSP AIGMSVPGTV TPNMHYVMPA QLGNENAMLQ  60
AQTAYPYPDP YYRSIFAPYD AQPYPTQPYP AQPMVHVQLM GIQQAGVPLP SDAIDEPVFV  120
NAKQYHGILR RRQSRAKAES EKKLLKARKP YLHESRHLHA LKRARGCGGR FTAKKTDNQP  180
KQDESGDNSQ VNINLDPGKN EVASAENAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-21114186173NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0133700.0BT013370.1 Lycopersicon esculentum clone 135390R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759701.11e-155PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X3
RefseqXP_016487790.11e-155PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X3
SwissprotQ84JP12e-61NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLM1BWA71e-127M1BWA7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000544161e-127(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.23e-49nuclear factor Y, subunit A7